PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010552725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 183aa    MW: 20625.5 Da    PI: 10.4555
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010552725.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-1564106448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++ +Ed+l+++++++lG++ W++Ia +++ gR++ q++++w+++l
   XP_010552725.1  64 FSGDEDDLIIKLHALLGNR-WSLIAGRLP-GRSDDQVRNHWNSHL 106
                      7789***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-54168IPR009057Homeodomain-like
SuperFamilySSF466893.16E-1941115IPR009057Homeodomain-like
PROSITE profilePS5129425.57956110IPR017930Myb domain
SMARTSM007171.7E-1460108IPR001005SANT/Myb domain
PfamPF002492.5E-1462106IPR001005SANT/Myb domain
CDDcd001673.16E-1264106No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2069107IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MRSLTTQEDM KRGALIMSEQ VNRKLIHTFR YRRGRLPLGG VRCGKSCRAR RINHARPELK  60
TGGFSGDEDD LIIKLHALLG NRWSLIAGRL PGRSDDQVRN HWNSHLKRKL MNMGMDPSNH  120
RLNHHNHCFC GREPHNNAMA DIAYKADDES SASHSTGPSD HGIVPVDPMP PTASLLERII  180
NVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-204211040108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010552725.11e-134PREDICTED: myb-related protein 330 isoform X1
TrEMBLQ8H2534e-45Q8H253_9R
STRINGVIT_01s0011g04760.t016e-43(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71030.12e-39MYB-like 2